Quick Answer: What’S The Opposite Of Laughing?

How do you spell laughing?

Correct spelling for the English word “laughing” is [lˈafɪŋ], [lˈafɪŋ], [l_ˈa_f_ɪ_ŋ] (IPA phonetic alphabet)..

What violate means?

verb (used with object), vi·o·lat·ed, vi·o·lat·ing. to break, infringe, or transgress (a law, rule, agreement, promise, instructions, etc.). to break in upon or disturb rudely; interfere thoughtlessly with: to violate his privacy. to break through or pass by force or without right: to violate a frontier.

What we call a lazy person?

lazy person. loafer. ne’er-do-well. slacker. sluggard.

What procrastination means?

noun. the act or habit of procrastinating, or putting off or delaying, especially something requiring immediate attention: She was smart, but her constant procrastination led her to be late with almost every assignment.

What’s the meaning of humorous?

1a : full of or characterized by that quality which appeals to a sense of the ludicrous or absurdly incongruous : full of or characterized by humor : funny humorous stories shared a humorous anecdote.

What is the opposite of cry?

Opposite of to shed tears, especially from being emotional. laugh. chortle. chuckle. giggle.

What emotion do you feel when you laugh?

the emotion it is expressed with: relief, mirth, joy, happiness, embarrassment, apology, confusion, nervous laughter, paradoxical laughter, courtesy laugh, evil laughter. the sequence of notes or pitches it produces.

What is the antonyms of beautiful?

Antonyms for beautifulawkward.bad.coarse.crude.drab.dull.homely.horrible.More items…

What is the opposite word of always?

forever; continually: at no time, never.

What is opposite of laughed?

▲ (laugh at) Opposite of past tense for to smile in a scornful or deprecating manner. praised. applauded. cheered.

What does laughter mean?

Laughter is defined as the sound of mirth or joy. Laughter is the sound you make when you hear a really funny joke that makes you giggle. noun.

What is the opposite of heaviest?

Antonyms for heaviesthappy.inconsequential.joyful.light.lightweight.moving.smoooth.trivial.More items…

What is the meaning of soft?

adjective, soft·er, soft·est. yielding readily to touch or pressure; easily penetrated, divided, or changed in shape; not hard or stiff: a soft pillow. relatively deficient in hardness, as metal or wood. smooth and agreeable to the touch; not rough or coarse: a soft fabric; soft skin.

What does seriousness mean?

Seriousness is a quality of being calmly intent, or serious. … Sometimes seriousness implies a bit of worry, like when you ask about the seriousness of your grandmother’s health problems. The noun seriousness comes from an adjective, serious, with a Latin root, serius, which means “weighty, important, or grave.”

Is witty a word?

adjective, wit·ti·er, wit·ti·est. possessing wit in speech or writing; amusingly clever in perception and expression: a witty writer. characterized by wit: a witty remark. British Dialect. intelligent; clever.

What is the opposite of laughter?

Antonyms for laughter gloom, sadness, unhappiness, despair.

What is the opposite of high?

What is the opposite of high?lowshortreedyskimpylankyinfinitesimalbonyteensy-weensybaby50 more rows

What is a word for not lazy?

1 good-for-nothing, idle, inactive, indolent, inert, remiss, shiftless, slack, slothful, slow, workshy. 2 drowsy, languid, languorous, lethargic, sleepy, slow-moving, sluggish, somnolent, torpid. Antonyms. active, assiduous, diligent, energetic, industrious, quick, stimulated.

What does Lafter mean?

noun The number of eggs laid by a hen before she sits.

What is the opposite of humorous?

What is the opposite of humorous?serioushumorlessUSsternunhystericalunplayfulmoroseno-nonsensesadsubduedtragic95 more rows

What is the opposite of hardest?

Antonyms for hardestdelicate.soft.vulnerable.weak.disputable.doubtful.easy.facile.More items…